Home >
Adrenomedullin (Human) Fc Fusion (HEK293)

Adrenomedullin (Human) Fc Fusion (HEK293)

$
Product Code: 01100-01-50
  • Human Adrenomedullin (Tyr95-Tyr146) Fc Fusion (HEK293)
  • Sequence: Human IgG1 Fc-95-YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-146
  • Size: 50 ug
  • Protein ID: NP_001115.1
  • Gene ID: NM_001124.3
  • Expression: HEK293 cells animal free
  • Human IgG1 Fc Tag on N-Terminus
  • MW: 39 KDa
  • Purity: 93% in SDS-PAGE and 95% in SEC HPLC.
  • Endotoxin: < 1.0 EU per ug of protein
  • Storage: Lyophilized Protein at - 70 C for 12 months.
  • Application: Cell Biology, Receptor Binding, Testing the Ligands of Adrenomedullin, Testing Anti human ADM (1-52) Monoclonal Antibody. In-Vitro Research Use Only.
Empty Cart